We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more.
Share this :
Print
Genscript Gastric Inhibitory Peptide (GIP), human
Genscript Gastric Inhibitory Peptide (GIP), human - GSCRPT (Additional S&H or Hazmat Fees May Apply)
List Price
$90.00
Your Price
$90.00
HOW MUCH YOU SAVE:
0.00 %
NETA PART: | GSCRPT-RP10795-0.5 |
MFG.PART: | RP10795-0.5 |
UNSPSC: | 41105322 |
Manufacturer: | GenScript USA Inc |
Overview
Description | GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits potent incretin activity in rodent and human subjects. The primary action of GIP is the stimulation of glucose-dependent insulin secretion. GIP may also play a role in adipocyte biology. |
Cas No | 100040-31-1 |
Sequence | {TYR}{ALA}{GLU}{GLY}{THR}{PHE}{ILE}{SER}{ASP}{TYR}{SER}{ILE} {ALA}{MET}{ASP}{LYS}{ILE}{HIS}{GLN}{GLN}{ASP}{PHE}{VAL}{ASN} {TRP}{LEU}{LEU}{ALA}{GLN}{LYS}{GLY}{LYS}{LYS}{ASN}{ASP}{TRP} {LYS}{HIS}{ASN}{ILE}{THR}{GLN} |
Sequence Shortening | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Molecular Formula | C226H338N60O66S1 |
Molecular Weight | 4983.6 |
Properties
Purity | > 95% |
Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
Form | Lyophilized |
Storage | Store the peptide at -20°C. |
SKU | GSCRPT-RP10795-0.5 |
---|---|
Supplier Part Number | RP10795-0.5 |
UM | EA |
UNSPSC | 41105322 |
Manufacturer | GenScript USA Inc |
ProductLine | GSCRPT |
Qty | 1 |
MinOrderQty | 1 |
Weight | 7.00 |
Lead Time | 7 Business Days |
Hazardous | N |