GenScript Exendin-4; 0.5mg

Name: GenScript Exendin-4; 0.5mg
SKU: GSCRPT-RP10874-0.5
Price: 147.00 USD

List Price $147.00 Your Price $147.00

GenScript Exendin-4 - GSCRPT (Additional S&H or Hazmat Fees May Apply)

NETA PART: GSCRPT-RP10874-0.5

MFG.PART: RP10874-0.5

UNSPSC: 41105322

Manufacturer: GenScript USA Inc

Description

Overview

Synonyms	Exendin4exenatide; Byetta
Description	Exendin-4 is a 39-amino acid peptide amide. Exendin-4, like Exendin-3, stimulates an increase in acinar cAMP without stimulating the release of amylase. Exendin-4 is a long-acting potent agonist of the glucagon-like peptide 1 (GLP-1). Exendin-4 is the active component of Byetta (exenatide) injection, which may improve glycemic control in people with type 2 diabetes mellitus and has the potential to reduce plasma glucose at least partly by a delay in gastric emptying as well as by reducing calorie intake. Exendin-4 enhances glucose-dependent insulin secretion by the pancreatic β-cell and suppresses inappropriately elevated glucagon secretion.
Cas No	141758-74-9
Sequence	{HIS}{GLY}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH₂
Sequence Shortening	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Molecular Formula	C₁₈₄H₂₈₂N₅₀O₆₀S
C Terminal	NH₂
Molecular Weight	4186.66

Properties

Purity	> 95%
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Form	Lyophilized
Storage	Store the peptide at -20°C.
Note	This peptide interacts interacts with exendin receptor to increase pancreatic acinar cAMP. It has no secretagogue activity and does not bind to VIP receptors.

Specifications